Peptide lexicon
Sermorelin
The first 29 amino acids of growth hormone-releasing hormone (GHRH 1-29) as the amide, the shortest fully active GHRH fragment.
| Substance class | Peptide |
|---|---|
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
| CAS number | 86168-78-7 |
| Molecular formula | C₁₄₉H₂₄₆N₄₄O₄₂S |
| Molar mass | 3,357.9 g/mol |
| Synonyms | GRF(1-29)NH2, GHRH(1-29) |
| PubChem | CID 16132413 |
Structure
Sermorelin corresponds to amino acids 1–29 of human GHRH with a C-terminal amide. It binds the pituitary GHRH receptor and is rapidly degraded by DPP-4.
State of research
Research covers pulsatile growth hormone release, the function of the somatotropic axis and comparisons with stabilised analogues such as Mod GRF 1-29.
Status
A former sermorelin product was withdrawn from the market; there is no authorisation in the EU. Sermorelin is on the WADA Prohibited List.
Literature
- Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic PerformanceSports Med, 2026 · PMID 41966639 · DOI 10.1007/s40279-026-02437-0
- Therapeutic Peptides in Orthopaedics: Applications, Challenges, and Future DirectionsJ Am Acad Orthop Surg Glob Res Rev, 2026 · PMID 41490200 · DOI 10.5435/JAAOSGlobal-D-25-00236
- A new era of doping? Use of peptide and peptide-analog drugs in recreational and professional sport and bodybuilding: a critical reviewJ Sports Med Phys Fitness, 2026 · PMID 41880199 · DOI 10.23736/S0022-4707.26.17773-1
- Beyond the androgen receptor: the role of growth hormone secretagogues in the modern management of body composition in hypogonadal malesTransl Androl Urol, 2020 · PMID 32257855 · DOI 10.21037/tau.2019.11.30
- Peptides in urology and sexual medicine: clinical effectiveness, dosing, indications, and safety: a narrative reviewSex Med Rev, 2026 · PMID 42862021 · DOI 10.1093/sxmrev/qeag078
